SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G006042_T03|PACid:20874353 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G006042_T03|PACid:20874353
Domain Number 1 Region: 144-276
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-41
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 682-755
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000471
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G006042_T03|PACid:20874353
Sequence length 826
Sequence
MVAAAAAAGGGADAGCGGGGGGGGKDALFVELWKACAGPLSSVPLLGEKVYYFPQGHIEQ
VEASTNHLAEHQGTPLYNLPWKIPCKLMNMELKAEPDTDEVYAQLTLLPDKKQDENTSAR
VENEEAEEEVVPHVPPATSEGLRIHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSQ
HPPNQELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFLRGENGE
LRVGVRRALRHQTTIPSSVISSHSMHLGVLATAWHAVNTGSMFTVYYKPRTSPAEFVVSR
ARYCESLKRNYSIGMRFRMRFEGEEAAEQRFTGTIVGICVSDPSGWADSKWRSLKVRWDE
ASSVPRPERVSPWQIEPAVSPSPVNPLPVRFKRSRSSVNASPSDVSTVNREVASKVMVES
QQNNLPRALHNQGRTQLTGRYRDSTDVKTAQDLTMWSSGTEQQRNNIAAQTKRCLEGWTQ
SRTPEGYNQLFSAFQPLKDAHNPLRPFPNKISGTRSSTWVTADARYPAQQANHNMLHGTL
SFMPHSSGFRMIQQNNLVTPEAANFTGKSAFTSLQGHVTDQCSTGWFGSIESNSHTDHAS
SSLIRSQPLVIGNDVQKTKGTSFKLFGIPLGSPEKSEPLVSPPSVAYDGKLQTSPTDNNE
PCSEATQNIQNKVQSSSTRSCKKVHKQGSALGRSIDLTKFACYDELIAELDQMFDFDGEL
KSPCRNWLVVYTDNEGDMMLVGDDPWNEFCDMVHKIFIYTREEVERMNPGALNARLEDCL
SDSLGRGLASKEPRSGPSTSAVDSENRANLSTLLKVVKQTKGHVSE
Download sequence
Identical sequences K7TJD3
XP_008662180.1.34533 GRMZM2G006042_P03 GRMZM2G006042_T03|PACid:20874353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]