SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G017187_T01|PACid:20846016 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G017187_T01|PACid:20846016
Domain Number 1 Region: 110-254
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.15e-45
Family B3 DNA binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G017187_T01|PACid:20846016
Sequence length 285
Sequence
MDAPNPGAAAGPGMPSDALYQELWHACAGPLVTVPRQGERVYYFPQGHMEQLEASAHHQQ
LDQYLPMFDLPPKILCRVVNVELRAEADSDEVYAQIMLQPEADQNELTSLDAEPQEREKC
TAHSFCKTLTASDTSTHGGFSVLRRHAEECLPQLDMSQNPPCQELVAKDLHGTEWHFRHI
FRGQPKRHLLTTGWSVFVSSKRLVSGDAFIFMRGENGELRVGVRRLMRQVNSMPSSVISS
HSMHLGVLATASHAISTGTLFSVFYKPRFDVVLLYLYICLQCTSY
Download sequence
Identical sequences GRMZM2G017187_T01|PACid:20846016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]