SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G024948_T01|PACid:20878786 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G024948_T01|PACid:20878786
Domain Number 1 Region: 98-207
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-29
Family B3 DNA binding domain 0.0000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G024948_T01|PACid:20878786
Sequence length 422
Sequence
MDQFAASGRFSREEEADEEQEDASNSMREISFMPPAAASSSSAAASASASASTSASACAS
GSSSAPFRSASASGDAAGASGSGGPADADAEAEAVEKEHMFDKVVTPSDVGKLNRLVIPK
QYAEKYFPLDAAANEKGLLLSFEDSAGKHWRFRYSYWNSSQSYVMTKGWSRFVKEKRLVA
GDTVSFSRAAAEDARHRLFIDWKRRVDTRGPLRFSGLALPMPLPSSHYGGPHHYSPWGFG
GGGGGGGGFFMPPSPPATLYEHRLRQGLDFRSMTTTYPAPTVGRQLLFFGSARMPPHHAP
PPQPRPFSLPLHHYTVQPSAAGVTAASRPVLLDSVPVIESPTTAAKRVRLFGVNLDNNPD
GGGEASHQGDALSLQMPGWQQRTPTLRLLELPRHGGESSAASSPSSSSSSKREARSALDL
DL
Download sequence
Identical sequences C4JC54
GRMZM2G024948_T01|PACid:20878786 NP_001183918.1.34533 GRMZM2G024948_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]