SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G030710_T01|PACid:20819732 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G030710_T01|PACid:20819732
Domain Number 1 Region: 158-278
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.01e-43
Family B3 DNA binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G030710_T01|PACid:20819732
Sequence length 736
Sequence
MAGIDLNDTVEEDEEEAEPGNACSQQSRTSSAATFPPPPPNQPRPSAAVCLELWHACAGP
VAPLPRKGSVVVYLPQGHIEHLGDAAAAGGGAPPPVALPPHVFCRVVDVTLHADASTDEV
YAQLALVAENEDVARRLRGRSEDGSAEDGDEGETVKQRFSRMPHMFCKTLTASDTSTHGG
FSVPRRAAEDCFPPLDYSQQRPSQELVAKDLHGTEWRFRHIYRGQPRRHLLTTGWSAFVN
KKKLVSGDAVLFLRGDNGELRLGVRRAAQLKNGSAFPALYNQCLNLGSLPNVAHAVATKS
VFHIYYNPRLSQSEFIIPFSKFIKSFSQPFSAGSRFKVKYESDDASERRCTGIIAGIGDA
DPMWRGSKWKCLMVRWDDDVDFRQPNRISPWEIELTSSVSGSHMSAPNAKRLKPCLPHVN
PDYLVPNGSGRPDFAESAQFHKVLQGQELLGYRTHDNAAVATSQPCEATNMQYIDERSCS
NDASNIIPGVPRIGVRTPLGSPRFSYRCSGFGESPRFQKVLQGQEVFHPYRGTLVDASLS
NSGFHQQDGSHVPTQASKWHAQLHGCAFRGQQAPAVPSQSSSPPSVLMFQRGDPKMSPFE
FGHFHVNKKEDRRAMFVHAGGIGGTEQTTMLQAHHVSGGTGNRDVTVEKSHPAVAAASDN
REVSKNSCKIFGISLTEKVPAMKEKGCGDINTNYPSPFLSLKQQVPKSLGNSCATVHEQR
PVVARVIDVSTVDMMI
Download sequence
Identical sequences A0A1D6MCU1
GRMZM2G030710_P01 GRMZM2G030710_T01|PACid:20819732 XP_008649995.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]