SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G044143_T01|PACid:20846084 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G044143_T01|PACid:20846084
Domain Number 1 Region: 2132-2418
Classification Level Classification E-value
Superfamily BEACH domain 4.97e-124
Family BEACH domain 0.0000000116
Further Details:      
 
Domain Number 2 Region: 2540-2610,2650-2767,2801-2846
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.79e-31
Family WD40-repeat 0.0087
Further Details:      
 
Domain Number 3 Region: 2006-2117
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-21
Family PreBEACH PH-like domain 0.0019
Further Details:      
 
Domain Number 4 Region: 262-299,345-489
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000269
Family Clostridium neurotoxins, the second last domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G044143_T01|PACid:20846084
Sequence length 2849
Sequence
MAEDAHELFDSSPPREEGSDEQLAAVPLGDEAGVVEEEEASDPGMSTSMPATPATPYEPP
PRPRRPPGVPADAPLEVVRAVEEAIAGGADLLREVVSQEQGELAHSVVDVLLGTMGGVDE
AGDATGTGAPPTVMISSRAAVAAAELLPYLPEDDEPSPRTRTALGLHAALRACTRNRAMC
SSAGLLAALLASAEKLFVEMDQGSRWDGTPLLQCIQMLGGHSLSVKDLHSWLDLVRKSLG
TSWATPLMLALEKAMGSMEAKGPAVTFEFDGESSGLLGPGDSRWPFLNGYGFATWIYIES
FSDTLSTATAAAAIAAAAAATSGKSSAMSAAAAASALAGEGTTHMPRLFSFLSSDNQGVE
AYFHGQFLVVESVGGRGKKASLHFTYAFKPQCWYFVGLEHTNKHSLLGKDDSELSLYVDG
SLYESRPFEFPRISKPLAFCCIGTNPPPTIAGLQRRRRQCPLFAEMGPVYIFKEPIGPDR
MRRLASRGGDTLPSFGNGAGLPWKATNDQVKSMAEESFSLNNGIGGSLHLLYHPSLLTGR
FCPDASPSGSSGTHRRPAEVLGLVHVSPRVRPSESLWALAYGGPMALLPLTIGNVHVDSL
EPAPGDLPSSLATISLSAPVFRIISQAIQHPGNNEELCRTFAPELLSRVLHYVLQALPKL
ESGEEVLTDEELVAAIVSLCQSQRNNHELKVQLFSSLLLDLNLWSSCNYGLQKELLSSLA
DMVFTESACMRDAKAMQMLLDGCRRCYWVIQEPDSIDNFAFTGTKRSLGEVNALVDELLV
VIELLLGAASSTAAADDVRCLIGFIVDCPQPNQVARVLHLIYRLNVQPNISRANLFSQSF
ITSGGVEALLVLLQREAKVGNKNILDHSSASENNVPKDGSSNRKADSADTSCQVDENQSA
ERHETVFHEEAIEHEATNAKDMLDSNIGSKVPGSENGLLKNLGGISFSITSDNVRNNVYN
VDKGDGIVVGIIHILGALIGSGHLKFDSGAGSANIPGGSQTTLNEEGNTMSEDRVSLLLF
ALQKAFQAAPRRLMTANVYMALISAVINVSSADESLNLYDSGHRFEHIQLLLVLLRSLPY
ASRAFQARAIQDILFLACSHLDNRTTMTSISEWPEWILEVLISNHEMDTKKNADGVSIGE
IEDLIHNFLIIMLEHSMRQKDGWKDVEATIHCAEWLSIVGGSSTGDQRIRREESLPIFKR
RLLGDLLDFSARELQVQQTEVIAAAAAGVAAEGLSPEEAKIQAENAAHLSVALAENAIVI
LMLVEDHLRSQAQHFCTSLTGDSITSSTSMTSLAASRSNSLSTAGKEPMAAGVSRRASLS
SDAGGLPLDLLTSMADSNGQISAAVMERLTAATAAEPYDSVKHAFVSYGSCITDLGESWK
YRSRLWYGVGIPPKSDIFGGGGSGWESWRSILEKDSNGIWIEFPLVKKSVAVLQALLLDE
SGLGGGLGIGGGSGPGMGVMTALYQLLDSDQPFLCMLRMVLVSMREDDNGEGDAFTKDVS
IKDVVSEGMGHQAGSVMPFDGNSYSSPRKPRSALLWSVLGPILNMPITESKRQRVLVASS
ILYSEVWHAIGRDRKPLRKQYIELILPPFVAILRRWRPLLAGIHELTSSDGQNPLIADDR
ALAADALPVEASLLMISPGWAAAFASPPVAMALAMMAAGASGTETRTPPRNTLNRRDKAL
PERKAAAKLQTFSSFQMPMETASNKPGSTLKDKAAAKAAALAAARDLERTAKIGSRRGLS
AVAMATSGQRRSSGDIERAKRWNTSEAMSAAWVECLQSDDSKSVVGRDFSALSYKYVAVL
VSCLALARNLQRAEMERQTLVDVLIRHRASTGLRAWRHLLHCLTEMGRLYGPFEHLCTPD
RVFWKLDFTESSSRMRRFVKRNYKGCDHLGAAADYEDRKLLNTSAQSNEHNSEDANSSLT
STLPSSASVIMADAMSMNDRNVENEQLETDTTRSSVDDDQLQHSSAADQQSVKGSIGSRT
SDICADRNLVRSTVLAPSYVPSEADERIIVELPSLMVRPLKVVRGTFQVTSKRINFIIDE
RSNDSNIDDAASTSGQCDQQDKDRSWLVSSLYQIYSRRYLLRRSALELFMVDRSNFFFDF
ADIDARKNAYRAIVHTKPPNLNDIFLATQRAEQILKRTQLMERWANWEINNFEYLMELNT
LAGRSYNDITQYPVFPWVVADYKSRVLNLDDPLSYRDLSKPIGALNPERLKKFQERYSTF
EDPIIPKFHYGSHYSSAGTVLYYLFRVEPFTTLSIQLQDGKFDHADRMFSDLSGTWDSVL
EDMSDVKELVPEMFYLPEVFTNINGIDFGTTQLGGKLDSVELPPWAENHVDFVHKHRKAL
ESEHVSAHLHEWIDLIFGYKQRGKEAIMANNVFFYITYEGTVDIDKITNPVDRRATQDQI
AYFGQTPSQLLTVPHMKRKPLAEVLQLQTIFRNPSELKSYVLPHSDRCNVPASAMLVSND
SIVVVDVNAPAAHVALHQWQANTPDGQGTPFLFHHGRNSTNSTSGALMRIFKGSAGSAED
YGFPRAIAFAASAIRSSAVVAVTCDKEIITGGHVDGSLKLISLDGAKTIETASGHIAPVT
CLALSPDSNYLVTGSRDTTVILWRIHQTGSSHKKNAQEPPPTTPTTPRSPLSGSTSTMSS
LSETKRRRVEGPMHVMRGHLGEVTCCSVSPDLGLVASSSNATGILLHSLRTGRLIRRLDV
DEAHAICLSSQGIILVWNGTKKTLSTFTVNGLPIANSVLLPFSGQVSCIEISTDGHFALF
GTSLFNNYKCDNSTETGDHELGPNGTDDVSKNSEQSVHAPSICFVDLHTLKVFHTLKLAK
GQDITAIALNKENTNLLVSTADNFFYSLY
Download sequence
Identical sequences GRMZM2G044143_P01 GRMZM2G044143_T01|PACid:20846084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]