SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G051174_T01|PACid:20880031 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G051174_T01|PACid:20880031
Domain Number 1 Region: 4-96,177-407
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.38e-83
Family IF2B-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G051174_T01|PACid:20880031
Sequence length 416
Sequence
MPDVQPLVSDFVLKLKRRKVEGSHAVARQTAELLRSVVSQHRMGSSANQAATLADAVRAV
GEQLIAANPIELAVGNIVRRVLHIIKEEDISSTAVGIEGLSVTVDSDDEYDSEHDDRPAL
SAAVLAAHARNALRAPSLQTLLEDIPVSPAISRTASSTGDSDGKSKSAGDKSSTRKLKHD
VIAAIGDLIDEIDSCYEPISEQAVELIHQNEVILTLGRSRTVKEFLYAAKEKKRSFRVFV
AEGAPRYQGHVLAKELVEKGVQTTVITDSAVFAMISRVNMVIVGAHAIMANGGVIAPVGM
NMVALAAQRHAVPFVVVAGSHKLCPLYPHNPEVLLNELKSPSDLLDFGEFSDCMNFSTQD
GSPLLNVVNPTFDYVPPKLVSLFITDTGGHSPSYMYRLIAEYYSADDLVVRRKATS
Download sequence
Identical sequences B4FQU2
GRMZM2G051174_P01 GRMZM2G051174_T01|PACid:20880031 NP_001149393.2.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]