SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G059939_T02|PACid:20819955 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G059939_T02|PACid:20819955
Domain Number 1 Region: 204-317
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-29
Family B3 DNA binding domain 0.0000123
Further Details:      
 
Domain Number 2 Region: 72-128
Classification Level Classification E-value
Superfamily DNA-binding domain 1.77e-16
Family GCC-box binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  GRMZM2G059939_T02|PACid:20819955
Domain Number - Region: 150-202
Classification Level Classification E-value
Superfamily Bacterial luciferase-like 0.0158
Family F420 dependent oxidoreductases 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G059939_T02|PACid:20819955
Sequence length 406
Sequence
MDSTSCLVDDASSGASTGKKPAPAPAAATGKPLQRVGSGTSAVMDAAEPGAEADSGGAGR
APGGVSGKLPSSKYKGVVPQPNGRWGAQIYERHQRVWLGTFTGEAEAARAYDVAAQRFRG
RDAVTNFRPLAESEPEAAVELRFLASRSKAEVVDMLRKHTYGEELAHNRRAFAAASPAAS
PPPENNRRPPAASSSSSPAAAREHLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQLPAAA
AAGVGSGGECKGVLLNFEDAAGKAWRFRYSYWNSSQSYVLTKGWSRFVKEKGLHAGDAVG
FYRSAGGKQQLFIDCKLRPNKTTTTAAAFVNVNAMTTTAAPPLAAVKAVRLFGVDLLTTP
RPAAVAPEQEEVTVANKRARDAMATAASTPAPVHMVFKKQCIDFAR
Download sequence
Identical sequences B4FXX4
GRMZM2G059939_T02|PACid:20819955 NP_001141742.1.34533 GRMZM2G059939_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]