SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G062154_T01|PACid:20826142 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G062154_T01|PACid:20826142
Domain Number 1 Region: 87-357
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 3.14e-89
Family Transcriptional factor tubby, C-terminal domain 0.00000827
Further Details:      
 
Weak hits

Sequence:  GRMZM2G062154_T01|PACid:20826142
Domain Number - Region: 63-80
Classification Level Classification E-value
Superfamily F-box domain 0.0168
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G062154_T01|PACid:20826142
Sequence length 357
Sequence
MPRHTAPAAPPSERGEMDEVVEADPDTEAEDQEERWATLLPELLSDVLLRVEASGAEQWP
ARKDIVSFACVCRWWRKAAVSVVRPPAESAKITFPSSLKQPGPRENPMQCFIMRNKNSTF
YLYLGFTSSPVYKGKFLMAARRLRRGPHTEYIISLDAEDLSQGSNSYMGKLRSDFWGTNF
KIYDSKPPYDGAKASSSRSSRRFGSRRISPQVSSGNYEVGQVSYKYNLLKSRGPRRMNCT
LECPSAQETWENSLKTKFRRPLGPTTLRNKAPRWHEQLQCWCLNFHGRVTVASVKNFQLV
TAAGPSDPTSNVDEETVLLQFGKVDDDIFTMDYRQPLSAFQAFAISLSSFGNKLACE
Download sequence
Identical sequences B6TPV6
NP_001150446.1.34533 GRMZM2G062154_T01|PACid:20826142 GRMZM2G062154_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]