SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G065496_T04|PACid:20869537 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G065496_T04|PACid:20869537
Domain Number 1 Region: 31-131
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-20
Family B3 DNA binding domain 0.00098
Further Details:      
 
Domain Number 2 Region: 252-356
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.81e-16
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G065496_T04|PACid:20869537
Sequence length 365
Sequence
MQQEHAQPSMVGAKGCERCRDWQEHYYWEHMDASKIRFFRCMTGDFAHRISVPEKFAKNF
KGQITEEFHLKSPSSAETWHVGVEKHGDKLFLVSGWENFAKAHELEENDLLLFACSGNSS
FEVLVFGASGCEKVSSLFGSGLGPDMGKQFNDVVRRHGVHHSVTVSDSEDTVAPSQLVRS
PRNALPLKEPSGKARPSKYESPNSSNFIVRHVATGKEGTDDEYANSNYYYSLSANRLGDE
EKEEIIGLAPIRPNNPVFVTLLRKNHVQRRNNCLIIPSKFAADHLGERAHNIILRRPNRK
EKWHVSYYHSRHTRCFQNLALFKFTRENKLHEGDICVFELMKGERRVTMTVHVVRKANGR
FILVV
Download sequence
Identical sequences B4FGA0
GRMZM2G065496_T04|PACid:20869537 NP_001132338.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]