SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G068586_T01|PACid:20851362 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G068586_T01|PACid:20851362
Domain Number 1 Region: 87-358
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 1.54e-93
Family Transcriptional factor tubby, C-terminal domain 0.00000867
Further Details:      
 
Weak hits

Sequence:  GRMZM2G068586_T01|PACid:20851362
Domain Number - Region: 63-80
Classification Level Classification E-value
Superfamily F-box domain 0.000213
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G068586_T01|PACid:20851362
Sequence length 358
Sequence
MPRDGAQAAPPPERGEMDEVVEADPDTEAEDQEERWARLLPELLSDVVRRVEASGGERWP
ARKDVVSCACVCRRWREAAVSVVRPPAESGKITFPSSLKQPGPRERPMQCFIKRNKNNST
FYLYLGFTSSPVDKGKFLMAARRFRRGPHTEYIISLDAEDLSQGSNAYMGKLRSDFWGTN
FKIYDSKPPYDGAKASSSRSSRRFGSRRISPQVSAGNYEVGQVSYKYNLLKSRGPRRMYC
TLECPSAQETWENSLKTKFRRPLGPTTLRNKAPRWHEHLQCWCLNFHGRVTVASVKNFQL
VAAADPSEPTTNVDDETVLLQFGKVDSDMFTMDYRQPLSAFQAFAISLSSFGTKLACE
Download sequence
Identical sequences B4FG04
GRMZM2G068586_P01 GRMZM2G068586_P03 NP_001132270.1.34533 GRMZM2G068586_T01|PACid:20851362 GRMZM2G068586_T03|PACid:20851363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]