SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G073750_T01|PACid:20830415 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G073750_T01|PACid:20830415
Domain Number 1 Region: 117-258
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-47
Family B3 DNA binding domain 0.0069
Further Details:      
 
Domain Number 2 Region: 754-830
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000916
Family PB1 domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G073750_T01|PACid:20830415
Sequence length 888
Sequence
MNLSPPRMSEPSLESDGEQRCLNSELWHACAGPLVSLPVVGSRVVYFPQGHSEQVAASTN
KEVDAQIPNYPNLPPQLICQLHNVTMHADAETGEVYAQMTLQPLSPEEQKEPFLPIELGA
GSNQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQHPPVQELVARDLHDNEWK
FRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSIIFIWNDNNQLLLGIRRANRPQTVMPSS
VLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRF
RMLFETEESSVRRYMGTITCISDLDSERWPNSHWRSVKVGWDESTAGDKQPRVSLWEIEP
LMAFPMYPTAFPLRLKRPWASGLPMFNGGRSDEFARYSSLMWLRDGNRGAQSLNFQGLGA
SPWLQPRIDYPLLGLKLDTYQQMAAAALEEIRAGDHLKQISSLLPVQQPQNLSGGLDPLY
GNPVLQQMQFQSQQSSLQVVQQGYGPNASDSGFLQNQLQLQKQQEPLPQQQQQALQQQSH
QEMQHHLSASCHDIANVASGVSESGSASQTESSLLSGSSYQQIYDGNSGPGLHLHNGFHN
CSSQESSNLLNLSRSGQFMASEGWPLKRLAVESLSGHELQPVQHKFEKVNHQSNVSHISS
TLPPLSARDSYSAQASGTNDQSHLLSSSFAIHDGLTAVRSGGVGSGTDAITIASLRYNDM
NLLPENPIATSSCLGESGTFNSLDDVCGVNPSQGGTFVKVYKSGSPGRSLDITRFSSYYE
LRSELERLFGLEGQLEDPVRSGWQLVFVDRENDILLVGDDPWQEFVNSVWCIKILSPQDV
QQMVRGGGDLLSTTGVRTLQGSVCDDYSAGHDMQNLTGSIAPVVPLDY
Download sequence
Identical sequences B8A0C3 K0DCR7
NP_001146279.1.34533 GRMZM2G073750_T01|PACid:20830415 GRMZM2G073750_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]