SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G073750_T02|PACid:20830416 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G073750_T02|PACid:20830416
Domain Number 1 Region: 117-258
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-47
Family B3 DNA binding domain 0.0069
Further Details:      
 
Domain Number 2 Region: 752-828
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000916
Family PB1 domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G073750_T02|PACid:20830416
Sequence length 886
Sequence
MNLSPPRMSEPSLESDGEQRCLNSELWHACAGPLVSLPVVGSRVVYFPQGHSEQVAASTN
KEVDAQIPNYPNLPPQLICQLHNVTMHADAETGEVYAQMTLQPLSPEEQKEPFLPIELGA
GSNQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQHPPVQELVARDLHDNEWK
FRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSIIFIWNDNNQLLLGIRRANRPQTVMPSS
VLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRPSEFVIPLAKYVKAVYHTRVSVGMRFRM
LFETEESSVRRYMGTITCISDLDSERWPNSHWRSVKVGWDESTAGDKQPRVSLWEIEPLM
AFPMYPTAFPLRLKRPWASGLPMFNGGRSDEFARYSSLMWLRDGNRGAQSLNFQGLGASP
WLQPRIDYPLLGLKLDTYQQMAAAALEEIRAGDHLKQISSLLPVQQPQNLSGGLDPLYGN
PVLQQMQFQSQQSSLQVVQQGYGPNASDSGFLQNQLQLQKQQEPLPQQQQQALQQQSHQE
MQHHLSASCHDIANVASGVSESGSASQTESSLLSGSSYQQIYDGNSGPGLHLHNGFHNCS
SQESSNLLNLSRSGQFMASEGWPLKRLAVESLSGHELQPVQHKFEKVNHQSNVSHISSTL
PPLSARDSYSAQASGTNDQSHLLSSSFAIHDGLTAVRSGGVGSGTDAITIASLRYNDMNL
LPENPIATSSCLGESGTFNSLDDVCGVNPSQGGTFVKVYKSGSPGRSLDITRFSSYYELR
SELERLFGLEGQLEDPVRSGWQLVFVDRENDILLVGDDPWQEFVNSVWCIKILSPQDVQQ
MVRGGGDLLSTTGVRTLQGSVCDDYSAGHDMQNLTGSIAPVVPLDY
Download sequence
Identical sequences A0A1D6MWK1
XP_008672720.1.34533 GRMZM2G073750_T02|PACid:20830416 GRMZM2G073750_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]