SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G076450_T01|PACid:20850261 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G076450_T01|PACid:20850261
Domain Number 1 Region: 305-407
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.71e-19
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 72-112,142-223
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000785
Family BTB/POZ domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G076450_T01|PACid:20850261
Sequence length 621
Sequence
MEPSSSITFASSSSYLSNGSSPCSVALPPPGPPQTPPLPAGQGWGGGVAAAGSGGSVEAV
SLNRLSKNLERLLLDPDLDCSDADVDVPDGGPPVPIHRCILAARSDFFYDLFAARGRAGA
ARGDAAAGAGVAAEGAASGRPRYKMEDLVPAGRVGREAFQAFLGYLYTGKLRPAPVDVVS
CADPVCHHDSCPPAIRSAVELMYAACTFKIPELTSLFQRRLLNFVDKTLVEDVIPILEVA
SHSGLTQVIDKCIQRIARSDLDDISLDKELPPEAVDEIKNLRKKSQTADGDTFISDPVHE
KRVRRIHRALDSDDVELVKLLLNESDITLDDANALHYAASYCDPKVVSELLDLAMANLNL
KNSRGYTALHLAAMRREPAIIMCLLNKGANVSQLTADGRSAIGICRRLTRAKDYNTKMEQ
GQESNKDRLCIDILEREMMRNPMAVEDAVTSPLLADDLHMKLLYLENRVAFARLFFPAEA
KVAMQIAQADTTEEFGGIVAVAASTSGKLREVDLNETPVTQNKRLRSRVDALMKTVELGR
RYFPNCSQVLDKFLEDDLPEGLDQFYLQRGTADEQKVKRMRFCELKEDVLKAFSKDKAEG
SVFSGLSSSSSCSPPQKYAQR
Download sequence
Identical sequences K7V8F5
GRMZM2G076450_T01|PACid:20850261 GRMZM2G076450_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]