SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G084173_T01|PACid:20822357 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G084173_T01|PACid:20822357
Domain Number 1 Region: 64-156
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000255
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G084173_T01|PACid:20822357
Sequence length 170
Sequence
MEAFAPDKICGSGRSAVTTQERVMEAQSSTCFSKVVGPNLWYGDRTRLTPKQEEAALGLS
RACGSGIPAYICTMKKSNVVKRQMVFSRQFSKRHIFGRLGTYGCETRVFAGRDLFGSKLN
FSMIHGGLRLLGGWPLFVKSHRIEAEHVCAFMFQEEEEGELSLRADLVIW
Download sequence
Identical sequences C4J9I3 K0DG56
GRMZM2G084173_T01|PACid:20822357 NP_001183635.1.34533 GRMZM2G084173_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]