SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G088413_T01|PACid:20864520 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G088413_T01|PACid:20864520
Domain Number 1 Region: 24-124
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-22
Family B3 DNA binding domain 0.0056
Further Details:      
 
Domain Number 2 Region: 226-331
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-17
Family B3 DNA binding domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G088413_T01|PACid:20864520
Sequence length 332
Sequence
MRKPSKGRKERDVIYHRNDHSDDRGKHFFKILIGEFHERLVIPVKFAKNFRGKIERSITL
ESLGGCTFDVQVAQNLGRIVFQSGWESFVSAHDLKMCDLLVFKYDGMSRMKVLVFDPSGC
EKVPPFFVTKNAMSGGRKREGPLDISSSDANLPMKTPETKKKAWKQRDRSRISIRSSRSL
SSSSGGMTASEDDEAHSVPSYVLPRHTSLDTMQKRKVKERLQAICSEIPIYVLVVKNTNI
SGRSRAMVFSRKYPDVCLPSKSGALILQCHGKSWQVMYCIEVWKDRGESKRLRNGWAQFA
RDNYLQLGDICLFEPLKTKKCTMNVHIIRKKE
Download sequence
Identical sequences GRMZM2G088413_T01|PACid:20864520 GRMZM2G088413_P01 XP_008665124.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]