SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G088427_T01|PACid:20870033 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G088427_T01|PACid:20870033
Domain Number 1 Region: 22-120
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-22
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 229-330
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.75e-17
Family B3 DNA binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G088427_T01|PACid:20870033
Sequence length 337
Sequence
MRKPSNGCKERDVIYHRNDHTDDNGKHFFKILIGDFHKRLVIPVKFAKKFRGKVERNIKL
ESLGGYTFDVQVAQNLGRIMFQSGWKSFVSAHDLKMFDLLVFKYDGMSRMKVLIFDPSGC
EKVPPFFVTKNAMSGGRKREEPQEPLDISSSYADLPMKTPETKKKARKQRDRSRINISPC
RSISNSSGGMRSSEDDEAHSVPSCILPRGTILDSMQRRKVKERLRAICSEIPIYVFVVKK
SNIFGRSQDMVFSRKYPDVCLPFKSGAVILQCHGKSWEVILEVRKDQGESKRLRIGWAEF
ARDNNLQLGDICLFEPLKTMKYTMNVHIVRRRVRSGK
Download sequence
Identical sequences XP_008665125.1.34533 XP_020402857.1.34533 GRMZM2G088427_T01|PACid:20870033 GRMZM2G088427_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]