SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G098063_T01|PACid:20863209 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G098063_T01|PACid:20863209
Domain Number 1 Region: 24-125
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-20
Family B3 DNA binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 219-322
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.22e-19
Family B3 DNA binding domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G098063_T01|PACid:20863209
Sequence length 324
Sequence
MMKPGERSRERDADFHYSGHDDEKDRYFFKVLVGDFRERLAVPDKFMQHFTRGLVTSSVT
LESRCGRSFHVQVAENLGKVVLQAGWKEFVAAHGLSMGDVLVFKHDGTPRLKVFMFDHSC
CEKVPPPCPVKIKREHHVCGGERRETHPEVPSSSCGDASMTFVTASSSSASPSDDASGEW
ILSPEDQKPRYVPGYILPNGTYLTCVQMQKLKERVRARTSTIPIYGCTVRKSNIRRGSQN
MAIPRAYADVYLPFEDRTLTLQRCGESWEVQCRIQKGRRGCKRLAQGWRQFAHDNKLQLG
DLCLFELLENTSKYTMDVHVVRAE
Download sequence
Identical sequences A0A1D6KXP0
GRMZM2G098063_P01 XP_008665123.1.34533 GRMZM2G098063_T01|PACid:20863209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]