SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G099542_T02|PACid:20868685 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G099542_T02|PACid:20868685
Domain Number 1 Region: 260-591
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 4.26e-90
Family IF2B-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G099542_T02|PACid:20868685
Sequence length 598
Sequence
MDIRRGPPPPRTASGGVEPRFRQVGFVTAAEPARGAATPAPASPAASDGLSPVMIPPPLI
PVPVPVPVAPASESLAPSSPPPDSSSRPDAVSDLDDDDDIDVSWARPPPPAFPEPNKRHL
TERKNEHAPPTPVSQKPKLSKAERRAIQESQRAAKAAAKEAGLKSTAMASDANTKQPKTA
KISLKKDVNQVNSPVASDKKTGERPPDKDRKKDAPQPRMQFDDTHRVVKAKKRSVVRQSE
AQNRVELFRHLPQYAHGTQLPDLESKFFQPDLMHPSVYKVGLQYLSGDISGGNARCIAML
LAFREAINDYSMPSEKILNRDLTAKISSYVSFLIECRPLSISMGNAIRFLKNRITKLPLA
FSESEAKVSLQSDIDRFINEKIIVADKVIVSHAVTKIRDGDVLLTFGSASVVEMIFDNAH
ELGKKFRVVVVDSRPNHEGQGLLRRLVAKGISCTYTHINAVSYIMHEVTRVFLGASSVLS
NGTVYSRVGTALVAMVAHAFGVPVLVCCEAYKFHERVQLDSICFNELGDPDAISRVPRDE
SLSNLKNWAENENLHLLNLKYDITPSDYVSMLITDYGMLPPTSVPVIVREYRREHVWI
Download sequence
Identical sequences XP_008662208.1.34533 XP_008662209.1.34533 XP_020402125.1.34533 GRMZM2G099542_P02 GRMZM2G099542_T02|PACid:20868685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]