SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G102845_T01|PACid:20876197 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G102845_T01|PACid:20876197
Domain Number 1 Region: 137-277
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.76e-40
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 1027-1093
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000085
Family PB1 domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G102845_T01|PACid:20876197
Sequence length 1147
Sequence
MKQSPASSGVTAAPVVPAPAPAAASTGAAPPCEGERKAPAINADLWYACAGPLVSLPPVG
SLVVYFPQGHSEQVAASMQKDIDAHVPSYPNLPSKLICLLHSVTLHADPDTDEVYAQMTL
QPVNTYGKEALQLSELALKHARPQMEFFCKTLTASDTSTHGGFSVPRRAAEKILPPLDFG
MQPPAQELQARDIHDNVWTFRHIFRGQPKRHLLTTGWSLFVGGKRLFAGDSVIFVRDERQ
QLLLGIRRASRQPTNISSSVLSSDSMHIGVLAAAAHAAANNSPFTIFYNPRASPTEFVIP
FAKFQKALYSNQISLGMRFRMMFETEELGMRRYMGTITGITDLDPVRWKNSQWRNLQVGW
DESAAGERRNRVSMWEIEPIAAPFFICPQPFFGVKRPRQIDDESSEMENLFKRAMPWLGE
EICIKDAQTHNTTMPGLSLVQWMNMNRPQSSTLNTGIQSEYLRSLSNPAMQNLGAAELAR
QLYVQNHLLQQNSVQLNASKLPQQVQPINELAKGSLSCNQLDVIINQQELKQEVGNQQRQ
QQPVNQAIPLSQAQTNLVQAQVIIQNQMQQQQQQQQQSPTRCQKGTSVQQLLLSQQQQDQ
NFQLQQQQQLLLQQLQQQNQQQQQQQQNQQQLNKLPAQLVNLAGQQAQLSDQELQLQLLQ
KLQQQSLVSQPTVTLSPLQVIQEQQKLLLDMQQLSSSHSLAQQRILPQQDSDVSLQASQA
PPPMKQEQQKPSQKQFVLADVSDVVYPQISSTNVLSKAGTQLMTPGATQSVLTEEIPSCS
TSPSTATGNHLAYPIIGRNEHCKVTIEKVPQSSSLMSIPTAGEAVTTPIMAKELSKLNHN
LKENVTTSKSPIVGTGHENLLNIVPSTDNLETASSATSLWPTQTDGLLHQGFPTNFNQQQ
MFKDALPDVEIQEVDPTNNAFFGINSDGPLGFPMETEGLLVSAINPVKCQPNLSTDVEIN
YRIQKDAQQEISTSMVSQSFGQSDIAFNSIDSAINDGVMLNRNSCPPAPPQRMRTFTKVY
KRGAVGRSIDIGRFSGYEELKHAVARMFGIEGQLEDRQRIGWKLVYTDHEDDVLLLGDDP
WEEFVNCVKCIRILSPQEVQQMSLDGDLGNNVLSNQACSSSDGGNAWKPRRDQNPGNPSI
GFYDQFE
Download sequence
Identical sequences GRMZM2G102845_T01|PACid:20876197 XP_008645235.1.34533 GRMZM2G102845_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]