SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G106673_T06|PACid:20856930 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G106673_T06|PACid:20856930
Domain Number 1 Region: 127-225
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.46e-23
Family B3 DNA binding domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G106673_T06|PACid:20856930
Sequence length 232
Sequence
MAEATPYEEQRRRQVEANKRKLEELQLHHLSAAIREAAAAAKPSLVKKRKARVPLDVADA
VMEPVRRSGRLANLPDKPVYREKVPDFGMKIRRTYGSVRRDLTNRVYATDDARSYAISKA
EDLEQELDSSFPIFIKPMTQSHVTGGFWLGLPIHFCRKYLPKRDEMITLVDEDDDESDTL
YLAMKRGLSAGWRGFAVQQKLVDGDCLVFQLIEQTKFKVYITRASSYYESED
Download sequence
Identical sequences XP_008676668.1.34533 XP_020406913.1.34533 GRMZM2G106673_T06|PACid:20856930 GRMZM2G106673_P06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]