SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G109753_T01|PACid:20872054 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G109753_T01|PACid:20872054
Domain Number 1 Region: 169-272
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 0.0000068
Family At5g01750-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G109753_T01|PACid:20872054
Sequence length 331
Sequence
MRWLSRLLSQAVAARRASAAARSNTSLVKGGSHGFASGGRDGSPEVPREWLRKLWVDELK
KQKEAARRWGVGSSLEVAGATEEAPSRSYQYEYSGSNPVEAKLAPLLARANLVIARDIEW
ANIMFAFEQESRYIIMDPLFPQSPVGFIREKSNIIFRQLLRTRRPFVAEITDAMGNEIFK
VRRPFWWINSSIYVEVNDKEIGVVHRRWHLWRRIYDLYLGNMQFAVVENPGFWNWTFNLV
DEDDKMLAQIDRNWRGLGFELFTDAGQYAIRFGDEGQSHKFAPAEDVEELHVVRQLTLPE
RAVALALAISLDSDYFSRRGGWGLPFLIATE
Download sequence
Identical sequences B6TAD3
GRMZM2G109753_T01|PACid:20872054 NP_001149067.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]