SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G114182_T01|PACid:20873924 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G114182_T01|PACid:20873924
Domain Number 1 Region: 265-487
Classification Level Classification E-value
Superfamily Tropomyosin 0.000016
Family Tropomyosin 0.0032
Further Details:      
 
Domain Number 2 Region: 501-692
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000373
Family Tropomyosin 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G114182_T01|PACid:20873924
Sequence length 1325
Sequence
MEAEVSAPADLKAPDKTTVHGDDKENIPNGNANLQVKEADNDEDDGTRSDGFELIDVKQN
FDSARVEEEMAAPRSTTVDTSPVTEESETQEDKTTAHEEQSVATNTRHLESSMLNQQTEQ
LEKLTMRIEELESENDKLVKDLTEAENKQSLHYSCLQEAQCSLAMKDKELAEVTESLKDL
GSELGTSKKRIQEIEAELDSSADKLCKLEELKDERSLHAAQEAKRASELDKMLELAQSNM
KEMEKHIGSLQEEVKGYQDKAADHQQIEESLRNTISELKVVQEALELSKSQVENLKQKLA
SQDTDFSKLTEELNLHCSSEESLKEKSLKLETELTTVLEELQAKGGLDKLKDENKTLQGS
LVDLNSKLSEKDSILHQAEDELSKAQLVLLEALSQKEELELNLNSLSEQHGKSKAFGENA
NQKILDLEAQIQAMHAAEQALKFELKEAEASVQAAEKKGSDLEQQLSEIENKFVKSSEEI
ELLKERIQQEAAVSAERGMQLQETVTSVEGYKEKIIELQSSLGSSVSKNQLLEQEVMELT
DKCSEHQEQAHSVRQRSLELEDLLHTSKTHAEGVYSRTQELEQELNNTYEMFKGVEEELE
QYRSKASQLSDDLEAYQTKAASLEAVVEAASEKEKEFMESLSQITEEKKKTESRNAEIEA
QLQEALEAVGQKEAESRNLNEKLVALESEIESSMHVNEALKQEINAKLVMVDELQEKCSF
ISSEKEEVAEKLSIHEEKLEHLTEEHSRGLELLSVAESRNKETESQLREVLEKLAQKEAE
VTDLTEKLALLEAENEKMTCLNEALKEVDAKLVMFDELQERFSSTLAEKEEAAEKLAVHE
RTISQLTEVHTRTLELHSVAESKNEEIGAQFLEALETISQKEGEVKESSSQKIKILEEQL
AETHSKVEHFLTEKESLVQETSSLNKEFEVHQNKLNDLQLALAAALAEKEAAFEEIHSLC
KTLDGMIEHKAELEIQVSSTIQEHEELKSKYQNTMEEKQMLSDKYETAKKELEDAIAKLE
EEMNVDKSEKESHISKLERQITLSEIKYMEEIKTMQVETTEKNEALTAKMQEHTDLQHEK
HELEQQLLEVRKELDGAYHTIVNQEEQASLREIKWDTFRIYSEDRLEAEQQRAEELELQV
AALKQQLQEAEEEQVSLREVQWEGDQNHSLNELKSQRQYATDLEKQIEDLTQKLRSADAH
YKQKATEERDKLAEITTEFSKLTHKVSKSVELEKKVQDLEQKLQLAYSKSDEQATDVLES
RSREFSLDSLSSLVKQQDRTQAADKASPSPTLQEVQEPSGTMAFKFILGVALLSVLAGVF
LGKRY
Download sequence
Identical sequences GRMZM2G114182_T01|PACid:20873924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]