SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G149940_T02|PACid:20842516 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G149940_T02|PACid:20842516
Domain Number 1 Region: 312-410
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-17
Family B3 DNA binding domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G149940_T02|PACid:20842516
Sequence length 449
Sequence
MANANGSSTGAGHSDLVRAISHEQHQAFMASVPRAAPGGVNVHHQQHFHQYPAGLIPAPV
ALPVHAPVSSQTSPYSAQIAVPPPPPPLIASPDHRLHSLPPTGCYQLDYSPYGNAAAPSQ
QHTSAIRGFADWGTHSNALMSLAHATSFGNNGSSNINNNGLLHQNLSPYTTHTWTTTYVQ
RPYNTAVYAPATMNMLQTPPFHSNSHEKESGAVFSNSFNMAPSVTPTSPFQLMSPSSTNY
TSTQIFEETNNLEMSSYGVMILQDTSRVFGGGDNESNNSEEPDPKPAVEMEDLNQGNDHT
SNKTANCQDYRMVLRKDLTNSDVGNIGRIVLPKKDAEPNLPILEDKDGLILEMDDFELPV
VWNFKYRYWPNNKSRMYILESTGEFVKRHGLQAKDILIIYRNKKSGRYVARAVKAEDIAP
PECECVEAGNPREECGFSVSPSINKKIIT
Download sequence
Identical sequences GRMZM2G149940_T02|PACid:20842516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]