SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G153233_T02|PACid:20870415 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G153233_T02|PACid:20870415
Domain Number 1 Region: 111-220
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.09e-29
Family B3 DNA binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G153233_T02|PACid:20870415
Sequence length 370
Sequence
MKEVAEERCLDPQLWHACAGGMVQMPPVRSRVYYFPQGHAEHAHGGGAADLAGARALPSL
VLCSVTGVRFLADPETDEVFAKIRLVPVAPGEVEFREPDEFSVDPADAREKLSSFAKTLT
QSDANNGGGFSVPRYCAETIFPKLDYRADPPVQTVLAKDVHGEVWKFRHIYRGTPRRHLL
TTGWSTFVNQKKLVAGDSIVFLRTEHGELCVGIRRVKRVSCGGMECMSGWNAPGYGALSA
FLKDEEGKMMKSHGGYMRGRGKVKITDVVNAASLAASGQPFEVVYYPRASTPEFVVKAAS
VQNAMRNQWCPGMRFKMAFETEDSSRISWFMGTIASAQVADPIRWPNSPWRLLQVLLDHM
FPILVCNTAL
Download sequence
Identical sequences GRMZM2G153233_P01 GRMZM2G153233_T02|PACid:20870415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]