SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G159399_T01|PACid:20879005 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G159399_T01|PACid:20879005
Domain Number 1 Region: 113-222
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.01e-28
Family B3 DNA binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G159399_T01|PACid:20879005
Sequence length 644
Sequence
MKEAGEERCLDPQLWHACAGGMVQMPPVRSRVYYFPQGHAEHAHGGGGATDLAGARARPL
PPLVLCTVAGVRFLADPETDEVFAKIRLVPAAPGEVEFGEPREFGIDPEDAREKLSSFAK
TLTQSDANNGGGFSVPRYCAETIFPKLDYRADPPVQTVLAKDVHGEVWKFRHIFRGTPRR
HLLTTGWSAFVNQKKLVAGDSIVFLRTEHGELCVGIRRAKRVSCGGMECISGWNAPVYGA
LSAFLKDEEGKITKGPGGYMRGRGKVEITDVVEAASLAASGQPFEVVYYPRASTPEFVVK
AASVQNAMRNQWCPGMRFKMAFETEDSSRISWFMGTIASAQVADTIRWPNSPWRLLQVSW
DEPDLLQNVKCVNPWLVEIVSSIPPIHLGTFSPPRKKLRVAQHPDFPFEGQLLNPIFHGN
PLGPSNSPLRCFSDIAPAGIQGARHAQFGLPLTDYQLNQLHLGFNRLGAMTPTPRISKGF
VISSAPASESVSCLLTIGTPQATEKSDDIKRPHIMLFGKPILTEQQMDSGGSREGLSQDR
KASELGLEDGHCKVFMESEDVGRTIDLSVFGSYEELYGQLADMFGIEKAEIMRHLCYRDA
AGAVRHTGEEPFNDFMKVARRLTIIEGTEGRPQKPLVEYMVERA
Download sequence
Identical sequences D9HNU4
NP_001335723.1.34533 GRMZM2G159399_T01|PACid:20879005 GRMZM2G159399_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]