SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G159399_T02|PACid:20879006 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G159399_T02|PACid:20879006
Domain Number 1 Region: 113-222
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.12e-28
Family B3 DNA binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G159399_T02|PACid:20879006
Sequence length 373
Sequence
MKEAGEERCLDPQLWHACAGGMVQMPPVRSRVYYFPQGHAEHAHGGGGATDLAGARARPL
PPLVLCTVAGVRFLADPETDEVFAKIRLVPAAPGEVEFGEPREFGIDPEDAREKLSSFAK
TLTQSDANNGGGFSVPRYCAETIFPKLDYRADPPVQTVLAKDVHGEVWKFRHIFRGTPRR
HLLTTGWSAFVNQKKLVAGDSIVFLRTEHGELCVGIRRAKRVSCGGMECISGWNAPVYGA
LSAFLKDEEGKITKGPGGYMRGRGKVEITDVVEAASLAASGQPFEVVYYPRASTPEFVVK
AASVQNAMRNQWCPGMRFKMAFETEDSSRISWFMGTIASAQVADTIRWPNSPWRLLQVLL
HPMFPIPICHTSL
Download sequence
Identical sequences B4FP29
GRMZM2G159399_P01 GRMZM2G159399_T02|PACid:20879006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]