SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G174610_T01|PACid:20823523 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G174610_T01|PACid:20823523
Domain Number 1 Region: 135-231
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.65e-24
Family B3 DNA binding domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G174610_T01|PACid:20823523
Sequence length 278
Sequence
MAAKASRAAASGAAYEEQRKKRVLENLKHLEDLGIAEMSKSLLQAARLQKLNKAGVRAGP
KERKKFDATEVRRSSRAKTTVSYKDDFGELDAFLRGTRRSGGRNTEHGREYTGRIPSYEQ
QQRAFRKAEKLQDSLDPNNPSFVKTMVRSHVSSCFWLGLPISFCKNNLPSKEFRMVLEDE
EGLEFDAVYIGNRTGLSGGWRGFAMHHNLEEGDSLVFELAEHDKFKIYIIKAIDDDVKEA
EPDDKNDNGVTKEEPDQEESPVAEPPKGAKRRKLRGRR
Download sequence
Identical sequences B4FSX9
NP_001141031.1.34533 GRMZM2G174610_T01|PACid:20823523 GRMZM2G174610_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]