SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G177244_T01|PACid:20825238 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G177244_T01|PACid:20825238
Domain Number 1 Region: 91-184
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-20
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 2 Region: 609-682
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000235
Family B3 DNA binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G177244_T01|PACid:20825238
Sequence length 694
Sequence
MQPATDTEVVGGAVKKEPEEIVVEVDGDGDEEAEKVVKRRRRRRKKTTAWDPHKKRACVD
CTKRCARIHGQPASPSALASSSSNARPVPAVPSFFKVMLGYFSEDMDIPPPFAKTIWDLA
GSNVFLEDAFGLRWRVRLCLRDGVLSFGHGWKNFVLDHAVSCGEFLVFRQIARSVFTVQM
FAPSAVERLHLCERNKRQSRKRKPRPQRQRTSSPSIQTVKATKNRVKNSNKKRQRTDDHQ
NGVRPRGHKSKTAAQVCVDDSDVPDPASEPKCPDTSERLPEAEVTEPQEISEPPAGRHER
EAQKVLDGEAEVADDSAMLEETETIYNARLTEHQVPAANETEHGECLANFDASIPLAMMD
LNEVSIDDIFLSADTYEFGSDMCNPEPFSVGLNMEGTTTGQNSGFSCLEELDTPQNHLSS
MGDGHCSLVPEAGPCTENNKEKADALETGASYFCDSSFHDIDINALPAKEPPSFGEDSPS
PRAGAEMHPNECGLSSCSQDRGNSSLLIINKQAAHKESDSFMTTKQDKPQGGQCSMQDGV
GRQHPTEITSRNAKPRESPELTRNPLGTGTGSESTHSGTSESGGLLALTENITKFCIAVP
APGQTWLEIPGRLPVIPRTKKHGRKVVMLKDPRMRLWPVLYQCTPRFNGIITGWVDVCRE
NRIKEGDTCEFELSGNSELSFQLQVRVPNTHPEC
Download sequence
Identical sequences A0A1D6N437
XP_008674686.1.34533 GRMZM2G177244_P01 GRMZM2G177244_T01|PACid:20825238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]