SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G181254_T01|PACid:20867683 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G181254_T01|PACid:20867683
Domain Number 1 Region: 158-265
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.84e-18
Family B3 DNA binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G181254_T01|PACid:20867683
Sequence length 418
Sequence
MYNVYMYPSLLIFRPEQHSPPPSLPPSLPLSASPNPGTQKTMATQQPLPPADCVGDNTVD
RDVWLACAAPFSRIPTVGDEVDYFPDGHIEQHLSAAPQPLPAQHRFHCTVTDVSLGVDDK
TDEVFAKISLRPRPGRAAAPPPGPGGSSNSPAPSPPQKLRYFTKELSQTDVYARFRIPLD
NEHVLPIPMVDTDGVQRQDVVMRDTSGKSWRFSKTYSVNPSKQHSLTTGWLDFAKAKRLA
AGDKIVFMRRPNGDLIVGVRRLDVPRYPLFDFQGPDPDQPAQDVMEAVRLAAAGRPFTVT
YFPRQAAVEFIVPRSEVDDALATSWEPGALVRMEVMEDENRQYTMWVVGRVEAIRQNIWR
MLEIIWGVPSHPPPLATMRSVNAWQVSRPWPPEGHRRREPHQFGDEAPGTQTQLEARR
Download sequence
Identical sequences K0D9Q4
GRMZM2G181254_P01 GRMZM2G181254_T01|PACid:20867683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]