SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G301194_T01|PACid:20843543 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G301194_T01|PACid:20843543
Domain Number 1 Region: 379-742
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.43e-118
Family Motor proteins 0.00000107
Further Details:      
 
Domain Number 2 Region: 20-160
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.45e-25
Family Calponin-homology domain, CH-domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G301194_T01|PACid:20843543
Sequence length 1033
Sequence
MARPAAGAHDVGMALRKAEEAAARRCEAARWLRQMEPAAAESLPERPSEEDFCAALRNGL
VLCKVLNRVNPGAVPKVVENPVITVQTFDGPAQSAIQYFENMRNFLVAVSAMNLLTFETS
DIEKGGSSMKVVDCILCLKGYHEWKISGGIGIWRYGGIVKIASSSKRPASHLNRGGGSDQ
QMLEFVHLLSEVSLEESRVEEAQHSLFQRFVLQVVRAFLLEWGEAEDLPLDDMVIETVLE
QACKEFTILLASHRNQVRSLLRKMMKDDNGTLSKMDLIETITKCLKENGECMSSSLRLPR
GSHGHLDDVGLLENQQEGLEKLKMSFNEMKLQVESTRAEWEEDLRRLESYFEAQNHNAYQ
KLLEENRKLYNQVQDLKGSIRVYCRVKPFPKAQSDQRSTVDHIGENGEILIANPQKQGKD
GRKIFTFNKIFGPSTSQSEVFADTQPLIRSVMDGYNVCIFAYGQTGSGKTYTMSGPDVTA
EETWGVNYRSLNDLFEISQTRADSITYDVKVQMIEIYNEQVRDLLMTDGANKRLEIRNNS
HVNGLNIPDANIVPVKCAQDVLDLMKVGQRNRAVGSTALNERSSRSHSVLTVHVQGKEVI
SGSTLRGCLHLVDLAGSERVDKSEATGERLTEAKHINKSLSALGDVISALAQKSSHVPYR
NSKLTQVLQDALGGQAKTLMFVHVNPETDSFSETMSTLKFAERVATIELGAARANKEAGQ
VKDLKEEIAKLKLALDEKENEVAQFKDLANRVTSEMRNARTRSPLTASMSLKPEVSQESS
VDTCTSEIRSSSSGKQRRFRSPLSVRELDDKSPVISRELYLSARKYKTPSPPVRSSLSVE
RGSFAKIVENTGSIDCTPISKVEVPPKVWSSNSKTTPSSVLTAQSLRKFRDSEENRTKIP
PAVRQSMAKNRSESTPKTHNEEKPANRHHSGTKARSEARNTRDSSEIENEFAGDEPTFHF
NRTAKKLPTKVMSRQSQNIDVSVRASVRGEMEPLTEGRQRRNWSKPPHAERTNMPLPDIR
RSVSLPRGKNPLV
Download sequence
Identical sequences A0A1D6E8U0
GRMZM2G301194_P01 GRMZM2G301194_T01|PACid:20843543 XP_008668261.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]