SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G313737_T01|PACid:20854639 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G313737_T01|PACid:20854639
Domain Number 1 Region: 445-551
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.89e-17
Family B3 DNA binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G313737_T01|PACid:20854639
Sequence length 1133
Sequence
MEDAVSGLRSSNSATSFVAAPVYDDDVFSSSATSQHNASILGRRQHLSRSARLQRRPLQH
LTVDPVSAVHGSDDSELSHSEVDRVLATVVLSNPREKVHDGLVGVTEFAHRPLAVYDSYV
EHDLYSFIPLLFYTEQAKEEQVPVDTPTRCSMRVLNCRTFPRQGLQGHPSSLVCPLVRRH
DGRFHLWFEPSVLVAPHTRGRAEQMTLSYDADAEADDYYNAPDVEIMVSNFGSTSTLSYL
EPDLMLPTRYRNILAGMLEKAVYEEGHDLFGVLYESRSLVGTIGSIDFSFEENDELVDRK
ETVVTSQLQEEMGSKEHTTGQFQTLDKPIADNSSAAVEFSNRNCWVSLIQGSSVYTPYPS
NRVEQGLVATLQSDEDGCDQQRDGESLPGSDNLFARAAIVFSHWWSSAAADDFRGQQLSR
LVNLAPRVQQSPGCLRCLVLGLMEEPRRPRFFKVLVVDFARRIEIPQGFLCHFPEGRDRK
PGTTAVASAKVVLTNAEGSSIWPVALESTDGRVFLTTGWPKFVEDNRLGKGEILIFKYHG
RMRFVVSIFGVDAVEKAGRWSARSGAQAAEKGTAGFLDSHEVVCSKDYLETYLSEETMED
DKAKAVAEVMKTLRVDKLTVDLFCAILCLCEWKVEAAAEYFNFCRGKPQIPEKSLKQKFV
FQFDFVKGQLQRFFPEDYDSEKIKKNNIESPNLSDQPLQRDLIVAPVKRRLVDEFKSCDL
SHRQKRKVKLQGNSLQTQTPRRSPRLVNVNNTCNKNKKVSKGRAKVLKTPPDATDQVKDR
AHKSCLLDEKLDNALKAVHEEATGSLSQDLRKLDSPRCEVGLSKEHGHDQGDTGKMLDEV
SDVENSKEHVGSDAMGNSESYMSTYCVEPLPTNSRLTAYSRINELSFTWKHSQHASSLEK
VLLDIQRDNFVNTIARIQKIVRDDPSDVLSADVIEATVQIEILKWGLCLQDKCAHKIVNT
MLDYAKKVKGRHNFNTEMRKEEFSAKLQDLLKWQLKELEFKYTSLESDYKKAMADASNFF
STFEEHRKKLHAIKDGIKDLQQACMTKDDEMQKLALQVAEHATAYQKSIMEKVRVKMALK
SHEQTLGYIKEQLASAESGSIDVGALVKIEMDNMSREIELSKQNLLNINFKKE
Download sequence
Identical sequences GRMZM2G313737_T01|PACid:20854639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]