SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G317900_T01|PACid:20878445 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G317900_T01|PACid:20878445
Domain Number 1 Region: 89-229
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.76e-43
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 854-921
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000177
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G317900_T01|PACid:20878445
Sequence length 975
Sequence
MIKQQQQQAPPAPAPAAAPPPSACEGEKKAPPINSELWHACAGPLVSLPPAGSLVVYFPQ
GHSEQFLDIKLTVNGDQYGKEALQLSELALKQPRPQTEFFCKTLTASDTSTHGGFSVPRR
AAEKIFPPLDFSMQPPAQEIQARDLHDNVWTFRHIYRGQPKRHLLTTGWSLFVSGKRLLA
GDSVIFVRDEKQQLLLGTRRANRQPTNISSSVLSSDSMHIGILAAAAHAAANNSPFTIFY
NPRASPTEFVVPFAKYQKALYGNQISLGMRFRMMFETEELGTRRYMGTITGISDLDPVRW
KNSQWRNIQVGWDESAAGERRNRVSIWEIEPVAAPFFICPPPFFGSKRPRQLDDESSEME
NLLKRAMPWLGEEICIKDPQTQNTIMPGLSLVQWMNMNMQQNSFANSAMQSEYLRSLSNP
NMQNLGVADLSRQLNLQNQILQQNSIQFSSPKLPQQMQLANELSKASLPLNQIGVGTKPQ
EQTQDPNNLQRQQQSMNQLLPLSQSQTNLVQAQQQLSNSQPLSQQQTMPQQSIQVPSRAT
PPPTTTVQQESQQKLPQKHVGFTDTSHTTIPPTTSVNTISVVGSPLMATGATHSVVTDEI
PSCSTSPSTANGNHIVQPVLGRNQLCSMINYEKVPQSTPMSIPSSLEAVTATPRSIKELP
KLNSNVKQSVMASKLPNAGHVAQNLTNNAPPTDYPETASSATSVWLSQADGLLHHSFPMS
NFNQQQQMFKAAAPETDIQGADPSNNTLFGINGDGQLGFPMGADDFLSNGIDASKYQGHI
STDIDGNYRISKDGQQEISSSMVSQSFGASDMAFNSIDSGMNDGGFVNRTSWPPAPPLKR
MRTFTKVYKRGAVGRSIDISQFSGYDELKHALARMFSMEGQLEERQRIGWKLVYKDHEDD
ILLLGDDPWEEFVNCVKCIRILSPQEVQQISLDGDLGNNILPNQACSSSDGGNAWRARCD
QNSGNPSTGSYDQFE
Download sequence
Identical sequences GRMZM2G317900_T01|PACid:20878445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]