SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G320754_T01|PACid:20876040 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G320754_T01|PACid:20876040
Domain Number 1 Region: 27-127
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-20
Family B3 DNA binding domain 0.0054
Further Details:      
 
Domain Number 2 Region: 228-332
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.94e-17
Family B3 DNA binding domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G320754_T01|PACid:20876040
Sequence length 333
Sequence
MRKPSKGCKERDANYHRNDHTDDHGGKHFFKVLVGDFHKRLVIPGKFAKHFADKVEGSIT
LESLGGYTFDVQVAKDLGRVVLQSAGWKSFVSAHYLKKMDFLVFKYDGMSRMKVLIFDPS
GCEKVPPSFVAENASSGGVKREAPIGLSGSYARLPMKAPETKRKSWKQMDRSRIIMNASS
SLSNSSGGMASSEDDEAHPVPSYMLPQGTRLDRLQKKILKERLRDICSEIPIYVCVLKKT
NISGHSQALEFSINYSDLYLPFKSRELILRCHGNSWEVLLRVKLPGAPRKCKRLCKGWAR
FAGDNSLQLGDICLFEPLDTKNGTMNVHIIRRD
Download sequence
Identical sequences A0A1D6GLP9
XP_008644655.1.34533 GRMZM2G320754_T01|PACid:20876040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]