SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G344521_T02|PACid:20871111 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G344521_T02|PACid:20871111
Domain Number 1 Region: 691-795
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-18
Family B3 DNA binding domain 0.0043
Further Details:      
 
Domain Number 2 Region: 494-599
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-16
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 3 Region: 3-56
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000332
Family PHD domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G344521_T02|PACid:20871111
Sequence length 798
Sequence
MNTVCEVCGDIGYRQLLLCCRDCKRCAVHQYCLDKVVYEASLIKWFCYECLQRRGEVTRI
SSLEKLSSERPLSQVHSRSPVQQLITKSVESVRDAGPWRDRKNESIATKYPSLNRTYPSI
KKHTKKKPIVKPMGNCTNRKVRMAKVTTHTSAEASRSCETIGTESSKSNHGKNQQVDHAN
PVALNTEQSFPLIVNSLGTLGDNHQYHLLETTEGLACKFKKVPQSLAAPLKRLEKRDNVV
LGSNNLGSSCFTADLGSSVLGKSGDKSNRMKDIGANLSSKHNDHGNQANQHTLVGSKNME
GKSVKAKHTVVDAHKNTSWTVDSLINVKDKSEVYGDSNRDILNDVTVQLDHRASNELLPR
STATNIPQLATLENDVVDTVMPYSPNGGCEESFSCPGIKNTPSVRERSVDPINISSDSHD
TIEASESSERFMECQKASLCRRRKTVKMAMVSSSSEESGEDTISENVSLGYVLACRSSLS
KAQKKRVTKLIQEIQPEFTVFISIMRMSNVKLPGPLLGITKEYAIAHFPDKTTNVTLETP
GKSKKWHPKFYKRDESRKNLLMGQWLDFVRDNHVQEGDICLFLPTKDEIRHTFMVYILHE
TTHSRCGAGFQRVGPCLGGASSAKMASEVHIEDEPTAGEHVSSDSDMPENSHEPLESGDS
DDPFEPPYFVPCRSPLSKSQKRMVEQRVRAIRSEVPICVAVMKNNNVGIAQRWMLELCSR
YASVYLPTKGQNILLQCKGKTWEAKMMFHNGRRWFLNGGWPDFARGNGLRVGDMCLFELK
KKKSTLTMAVHIIRKEQF
Download sequence
Identical sequences A0A1D6KXR4
GRMZM2G344521_T02|PACid:20871111 GRMZM2G344521_P02 XP_008665132.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]