SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G352159_T03|PACid:20829404 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G352159_T03|PACid:20829404
Domain Number 1 Region: 51-186
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-41
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 625-698
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000132
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G352159_T03|PACid:20829404
Sequence length 750
Sequence
MNIELKVEPDTDEVYAQLTLLPDKKQDENTSTTVEEEEVVVPPALPATNEGPHIHSFCKT
LTASDTSTHGGFSVLRRHADECLPPLDMSQHPPNQELVAKDLHGAEWRFRHIFRGQPRRH
LLQSGWSVFVSAKRLVAGDAFIFLRGENGELRVGVRRALRHQTTIPSSVISSHNMHLGVL
ATAWHAVNTDSMFTVYYKPRTSPAEFVVSRDRYYESLKRNYSIGMRFKMRFEGEEAAEQR
FTGTIVGIGASDPSGWADSKWRSLKVRWDEPSSISRPERVSPWQIEPSVSPCHVNPLPVR
FKRSRSSVNALPSDVSTVTREVTSKVMADSQQNSLTRALHNQGRTQLTVRYHDNSDVKTT
QDLTVWSSGTEQQRNNIAAQTKLCLEGWTPTRSPEGYNQIFSAFKPLKDIHNPLGPFPSQ
ISGTHSNSWDTADARYPVQQANYSMLPGTWSLRPHNSGFRMNQQNYLVMPEGANFTGKSA
FTSLQDHGTDKCSTGCFGHIESSSHTDHASSSLIRPQPLVLGNGVQKSKGTSFKLFGIPL
GSPEKSEPLVSPPSVAYDGKLQTSPSEKGNQLDVVEVDNCSHPSKTVKPLDGPQSDSITE
NNQPSPEATLNIQNKVQSSSTRSCKKVHKQGSALGRSIDLTKFACYDELIAELDQMFDFD
GELKSPCKSWLVVYTDNEGDIMLVGDDPWNEFCDMVHKIFIYTREEVERMNPGALNSRSE
DSLSDSLGRGVASRDPRGGGSTSALDSENC
Download sequence
Identical sequences A0A060CYB4
GRMZM2G352159_T03|PACid:20829404 GRMZM2G352159_P03

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]