SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G352159_T07|PACid:20829406 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G352159_T07|PACid:20829406
Domain Number 1 Region: 131-238
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.4e-35
Family B3 DNA binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G352159_T07|PACid:20829406
Sequence length 661
Sequence
MAAAACAGAEAGRGCGGKDALFVELWKACAGPLSCVPPLGEKVYYLPQGHIEQVEASTNQ
LAEQQGTPLYNLPWKIPCKLMNIELKVEPDTDEVYAQLTLLPDKKQDENTSTTVEEEEVV
VPPALPATNEGPHIHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSQHPPNQELVAK
DLHGAEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFLRTSPAEFVVSRDRYYE
SLKRNYSIGMRFKMRFEGEEAAEQRFTGTIVGIGASDPSGWADSKWRSLKVRWDEPSSIS
RPERVSPWQIEPSVSPCHVNPLPVRFKRSRSSVNALPSDVSTVTREVTSKVMADSQQNSL
TRALHNQGRTQLTVRYHDNSDVKTTQDLTVWSSGTEQQRNNIAAQTKLCLEGWTPTRSPE
GYNQIFSAFKPLKDIHNPLGPFPSQISGTHSNSWDTADARYPVQQANYSMLPGTWSLRPH
NSGFRMNQQNYLVMPEGANFTGKSAFTSLQDHGTDKCSTGCFGHIESSSHTDHASSSLIR
PQPLVLGNGVQKSKGTSFKLFGIPLGSPEKSEPLVSPPSVAYDGKLQTSPSEKGNQLDVV
EVDNCSHPSKTVKPLDGPQSDSITENNQPSPEATLNIQNKVQSSSTRSCKKVHHMLHLFP
C
Download sequence
Identical sequences GRMZM2G352159_T07|PACid:20829406 GRMZM2G352159_P07

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]