SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G361376_T01|PACid:20825062 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G361376_T01|PACid:20825062
Domain Number 1 Region: 111-226
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.66e-19
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G361376_T01|PACid:20825062
Sequence length 377
Sequence
MATAAKLPSLYAELAAKSSRVAELEVRISALETENAGLRGGAGGSETRINRQYRKGGGPN
LSPISGTPTRNRARGATTRRALRLSVLTRGKARTRVSVPSRLFGSGWWLERAWVKLKRMS
HMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLEFWSRFKECKRTSMRSYVMAAPQTTGCS
AFVNKKKLVSRDAVLFLRGDNGELRLGVRRAAQLKNGSAFQLFITSAQIGSGRLLAYISA
CPGQCGRADGYNIASQAHDDRGRFISRVVPDVGTGREIFNAYCSLHMIIYHRLQHVMLLM
LLQGQQDRAARPVGVHPGNLPGKDLPPRCGLPQVFPSRAAKGGAARLDPYCCTGMGIGKM
LFTARPDMSAFLNISPK
Download sequence
Identical sequences GRMZM2G361376_T01|PACid:20825062 GRMZM2G361376_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]