SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G378580_T01|PACid:20857208 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G378580_T01|PACid:20857208
Domain Number 1 Region: 143-278
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.67e-40
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 718-793
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000288
Family PB1 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G378580_T01|PACid:20857208
Sequence length 850
Sequence
MTSSAAAAAAAAQVAGGGGGGEGDAAAAARGGGGTEDGMYTELWNLCAGPLVTVPRVGDK
VYYFPQGHIEQVEASTNQVAEQHMQFYDLPWKILCEVMNVELKAEPDNDEVYAQLTLLPE
SKQPEENGSSEEMPASPPAALARPRVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDM
TRQPPTQELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFLRGDS
GELRVGVRRAMRQQANVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPRTSPAEFVV
PCDRYMESLKRNYPIGMRFKMRFEGEEAPEQRFTGTIVGNVDPDQAGWAESKWRYLKVRW
DEASSIPRPERVSPWQIEPAVSPPPINPLPVHRPKRPRSNAVASLPESSAPTKEAAPKVT
LETQQHALQRPLQTQDNVAPKSVFGDNSELDSAHKSSLRPSGFDLDKSTIGMQRKLGSDI
WMRMNRPDGYSEMLSGYQPPNEGARNSQGFCSLPDQIAAGRPNFWHTVNAHYQDQQGNHN
LFPGSWSMMPSSTGFGMNRQSYPMIQEVGGMSQSCTNTKFGNGVYAALPGRGIDRYPSGW
FGHTTPGGRVDDAQPRVIKPQPLVLAHGEALKMKGNSCKLFGIHLDSPAKSEPLKSPPSV
ATPAAEKWMADGIDADKSPEPHKTPKQLGATQVDPVPERCPQASRGTQCKSQGGSTRSCK
KVHKQGMALGRSVDLTKFNGYTELVAELDEMFDFNGELKGCSKEWMVVYTDYEGDMMLVG
DDPWNEFCSMVHKIFVYTREEVQRMNPGALNSRPEDSGLANSTERGSASTAAAREAPGYQ
SASSLNSDNC
Download sequence
Identical sequences D9HNU0
XP_008676891.1.34533 GRMZM2G378580_P01 GRMZM2G378580_T01|PACid:20857208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]