SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G390641_T02|PACid:20822409 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G390641_T02|PACid:20822409
Domain Number 1 Region: 116-223
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-29
Family B3 DNA binding domain 0.0015
Further Details:      
 
Weak hits

Sequence:  GRMZM2G390641_T02|PACid:20822409
Domain Number - Region: 612-685
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0333
Family PB1 domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G390641_T02|PACid:20822409
Sequence length 690
Sequence
MITFVDSAAMELERESGRCLVDPQLWHACAGGMVQMPPVHSRVYYFPQGHAEHAQGHAHA
DLPAGRVPALVLCRVDAVRFLADPDTDEVLARVRLAPVRPNEPDHADAAAPGAREDKPAS
FAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSADPPVQTVLAKDVHGVVWKFRHIYRGT
PRRHLLTTGWSAFVNQKRLVAGDSIVFMRTGNGDLCVGIRRAKKGGIGGGPEFPHHQPPD
GGGYGYGYAGFSTFLRGEEDDAAARGKVRVLVRPEEVVEAANLAASGQPFEVVYYPRAST
PEFCVKAGAVRAAMRTQWCAGMRFKMAFETEDSSRISWFMGTVAAVQVADPIRWPNSPWR
LLQNVKRVSPWLVELVSSTPAIHHLTPFSPPSRKKLCIPLYPEGHQLPAPMFHGSPLVGR
GVGPMRYFPDGGTPPAGIQGARHAQFGISLPDLHHLTRLQSSLSPHAHGLRHQLDHGARP
RIAGGLIVGHPAARDDISCLLTIGTAPHKKPSDVKSAAAAPAPQLMLFGKPILTEQQISL
GFRPLPAPKKSPSDDAAETERTVSNNSDASSPAGTASGSTPSISGGAPSSCQDNKAAATA
TATDDDDLLGHCKVFMQSEDVGRTLDLSAVASYEELYQRLADMFGVDRAELTSHVFYRDG
ASGALKHAGDEPFSEFTKTARRLTIQTDAR
Download sequence
Identical sequences GRMZM2G390641_T02|PACid:20822409 GRMZM2G390641_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]