SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G393146_T02|PACid:20840389 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G393146_T02|PACid:20840389
Domain Number 1 Region: 5-540
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.75e-89
Family Acetyl-CoA synthetase-like 0.0000192
Further Details:      
 
Domain Number 2 Region: 760-1064
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.06e-36
Family Quinoprotein alcohol dehydrogenase-like 0.0077
Further Details:      
 
Domain Number 3 Region: 554-616
Classification Level Classification E-value
Superfamily ACP-like 0.00000594
Family Peptidyl carrier domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G393146_T02|PACid:20840389
Sequence length 1140
Sequence
MAAAEPCCISHAFERATRQEPGRLAVIHAAASGADSEERRFTCGDLLAAVGSLSRRIAAA
LGSTATDTRRDREQGSGFRAAGAVVPRVVGVYASPSLEYVAAVLAVLRCGAAFLPLDPSW
PEERVSWAISASNAALVVSSVGSRGATLFESSACPVLRFYGGIRRRFRDGNGGDDGEELV
WPCEHEWHRKFCYVMFTSGSTGKPKGVCGTEKDDVLLFKTSVSFVDHLQEFLSAVLTCST
LVIPPSEWRANPASLANLIKVYRISRMTLVPSLMEIILPTLAEKLSDGCNPLKILIFSGE
VLSVSLWKRVYEFLPEATIINLYGTTEVSGDCAFFDCKKLPTILEQEELNSVPIGFPISN
CEVSLVTNDGLSDEGEISVSGACLFTGYLADPMTSNCPEGSEVLAYYRTGDFARRLKTGE
LIFLGRKDRIVKIYGHRFSLEEVESTLRDHPDVSDAAVTFQSNGSLDFKAYLVLRSNNKF
LKCTQGYSGLHSSRDIIAPLRNWLIMKFPLAMVPRLFIPMKSLPLTLSGKIDYVKLSSLV
CAFEPCEIHPESSPADPHMQVIKKAFSDALLVHEVSEYDDFFSLGGNSITAAHVAHKLEI
DMRLLYIYTTPSKLFHGLLGEHSHVIPPTPEFHNRKKLRKYASISDSFGPVSEYLDSNFH
DQGQISKEGAYDHFAGNHVSDIDGQLSKSRTYNTYQAKNLCPDTCSNDEIFSGRPWILNF
HLQKVWSIGRCNRFMHGSEGMVHLEDICSYVPYNKKGYLVKIWSILLDSCVDASPLLVIN
NGMMSIFIGSHSYLFLCIDGYSGSVRWSVKLEGRIECSAAITGDFSEVVVGCYKGKIYFL
DMSTGKLSWTFQTDGEVKMQPVVDKMRNLIWCGSYDHYLYALNYKDRCCTYKVFCGGSIY
GSPAIDMAQNVIYVASTSGLVTAVSFKEPSFRVLWQYEAGAPIFGSLAIDHQSGTVICCL
VNGLVMTLNSQGSVVWKATVGGPIFAGACLSPTLPHQVLIPSRDGNLYSFDTVSGALLWV
YKAGDPITASTFVDELLTSVSFGPSERFACICTSSGKVHVIRIRVDIRTRVDAKYNQEQG
GDGVKSEELVQGLDAKYNQEQAGEGAKSEELVQGLASIDLPGDIFSSPLMAGQSCRCSLQ
Download sequence
Identical sequences GRMZM2G393146_P02 GRMZM2G393146_T02|PACid:20840389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]