SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G405699_T03|PACid:20821690 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G405699_T03|PACid:20821690
Domain Number 1 Region: 97-180
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000145
Family B3 DNA binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G405699_T03|PACid:20821690
Sequence length 180
Sequence
MLMPPPRIMPMPLPTLSLQELSLIGARPTVPLPHSPPLLPPIHPSTTTSPSLMPYGPITC
STRMYPTLLTLHHMSRCAIPTSRISIQKFDSGEYQVILRKELTKSDVANSGRIVLPKKDA
EAGLPPLVQGDPLILQMDDMVLPIIWKFKYRFWPNNKSRMYILEAAGEFVKTHGLQAGDT
Download sequence
Identical sequences GRMZM2G405699_P03 GRMZM2G405699_T03|PACid:20821690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]