SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G451231_T01|PACid:20875576 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G451231_T01|PACid:20875576
Domain Number 1 Region: 330-609
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.96e-70
Family Motor proteins 0.0000316
Further Details:      
 
Domain Number 2 Region: 25-155
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.17e-21
Family Calponin-homology domain, CH-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G451231_T01|PACid:20875576
Sequence length 867
Sequence
MAAAVLEEALRWGGGSVGDDNVAARRAEEAAIRRHEAASWLRKTVGIVCAKDLPEEPSEE
EFQLGLRNGIVLCNALNKVQPGAIPKIVGVQSDTAVPADGSALCAYQYFENLRNFVVVIQ
DFGLPTFEVSDLEKGGKSVRIVDCVLALKSFSESKKTGRQAACKYGGILKPLVSGNYFIL
KNCDAFMNKNARIHTEEATLNGFRGEQNLSLDCSPESYEVITSDNLSTIIRTILLDKKPE
EIPLIVESLLNKVIQEYELRFANQNLMDEEKQNNLTTKEEASFAVNGSNAAQKFHLKAEI
NFDLQHKQIKGLRGTVSSIKSGMEQLKLHYSEEFTKLGKHLYTISNAASGYHKVLEENRK
LYNQIQDLKGNIRVYCRVRPFLPGQISSLSSVAGMEERTITIMTPTKYGKDGNKSFTFNK
VFGPAATQDEVFSDMQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGPKVLTEESLGVNYK
ALNDLFNLQAQRKGTIDYDISVQMIEIYNEQKGLAVPDASIVPVTSTSDVVELMNQGQKN
RAVGSTAINDRSSRSHSCLTVHVQGRDLTSGTVLRGGQAKTLMFVHISPELDAAGETIST
LKFAERVASVELGAAKQNKEGSEIRELKEQIASLKAALAKKEGEPENILSTRSSPSIYRI
RKGNATPATPKDRQPMEEVGSLEVQNVFTPAQKRSKMHLLGILTENNSSNSVQNCNVPQK
EIGLGGWVDKMALGDNHFENSNSILELEPDTAQLPTSFYHQRYSPVQQSCRTESVPSLGL
HGFDSATSCSNQEIVVSTMGLKASGVANRGASTVKKYEATSTRSTNLASKSPLLQKKLQT
PTRNRNQLTSSTIGGRRTPNGKIGIAK
Download sequence
Identical sequences GRMZM2G451231_P01 GRMZM2G451231_T01|PACid:20875576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]