SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G472945_T01|PACid:20876437 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G472945_T01|PACid:20876437
Domain Number 1 Region: 138-355
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 8.89e-35
Family Transcriptional factor tubby, C-terminal domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G472945_T01|PACid:20876437
Sequence length 402
Sequence
MATVPNPKTTRARREPALRPRSNNVAAAPAPAPAVASVRRGPAASAEKENQPPKSLGHGK
AAAAATAAEPPKPAEPAPVVAPPPPPLRPSSLQLRMKDEAAAAALPAFVVGPRGRELLPP
PSSNYEAWDLSDSESAPASSWATLPNRALLCRPLPQDVGRCTCVIAREAATGARGVALYS
LYTNEGQGRQDRKLAVARHRRRRGRSEFVVAQNQDGIFCTADTSFLGAVRANLVGSKYRI
WGQGDELKNQSKRLLAVVAFAPTITTLTGSFRSLRAWIPKNQSMQLKANSSAQIQHVSGL
PKDWQEKKSRADQLCSRAPFYNHMTKRYELDFRERAGRMGYKVQTSVKNFQMTLEVAAFH
FCGSYVARIRDHQIHNTHLTLLGRKMGGRRCCSLVGLANPST
Download sequence
Identical sequences GRMZM2G472945_P01 GRMZM2G472945_T01|PACid:20876437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]