SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G472945_T02|PACid:20876438 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G472945_T02|PACid:20876438
Domain Number 1 Region: 138-401
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 3.4e-60
Family Transcriptional factor tubby, C-terminal domain 0.0000808
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G472945_T02|PACid:20876438
Sequence length 402
Sequence
MATVPNPKTTRARREPALRPRSNNVAAAPAPAPAVASVRRGPAASAEKENQPPKSLGHGK
AAAAATAAEPPKPAEPAPVVAPPPPPLRPSSLQLRMKDEAAAAALPAFVVGPRGRELLPP
PSSNYEAWDLSDSESAPASSWATLPNRALLCRPLPQDVGRCTCVIAREAATGARGVALYS
LYTNEGQGRQDRKLAVARHRRRRGRSEFVVAQNQDGIFCTADTSFLGAVRANLVGSKYRI
WGQGDELKNQSKRLLAVVAFAPTITTLTGSFRSLRAWIPKNQSMQLKANSSAQIQHVSGL
PKDWQEKKSRADQLCSRAPFYNHMTKRYELDFRERAGRMGYKVQTSVKNFQMTLEENGRQ
TVLQLGRVGKSKYIMDFRYPLTGYQAFCICLASIDAKLCCTL
Download sequence
Identical sequences C4J220
GRMZM2G472945_P02 GRMZM2G472945_T02|PACid:20876438 NP_001182945.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]