SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G475263_T01|PACid:20831393 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G475263_T01|PACid:20831393
Domain Number 1 Region: 108-248
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-37
Family B3 DNA binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G475263_T01|PACid:20831393
Sequence length 686
Sequence
MAQGAGRDPEELFEELWRACAGPLVELPQTNERVFYFLQGHLEQLQEPTDPALLAEQIKM
FQVPNKILCKVVNVELKAETETDEMYAQITLQPEPDQVDLPQLPEPPLQETSRPVVHSFC
KILTPSDTSTHGGFSVLRRHANECLPALDMSMPTPTQELITKDLHGSEWRFKHIYRGQPR
RHLLTTGWSTFVTSKKLIAGDAFVYLRSETGQQRVGVRRLVQKQSTMPASVISSQSMHLG
VLASASHAIRTHSIFLVYYRPRLSQSQYIVRLNKYLESSKIGFDVGMRFKMSFEGDDVPI
KKFSGTVVDKGDLSPQWQGSEWKTLKVKWDEATNLNGPERVSSWEIEPFDASAPAITMPV
QPSMKNKRPRETAEGLDIHALEPAQEFWLSGRPEQHEKTSVSSSEPKHQVAWTSERAGYS
AMSSSICQNSAVTGSWFKGFNSSGSHPSLPEISQKLFQVTSNDARVPPWPGLSAYHADEP
SSKLSCNTALCSYQTEEVAPRFSNAVEEEKKEPGMFRLFGVNLINHARSSATADKTSVGA
GETSARAAGSFEDSAQLSRVTKDHTHMVNGSPREIQSHQSCSGRSRIKVQMHGNDVCRAV
DLGNLDGYEQLMGEVGEMFEIKDLGSKEKEEWKVTFINDENETMEVGAVPWQEFCQMVRK
IVIHSIGDRGHMEACPCLGQDGKRDY
Download sequence
Identical sequences D9HNT4
XP_008673473.1.34533 GRMZM2G475263_T01|PACid:20831393 GRMZM2G475263_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]