SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G475263_T02|PACid:20831394 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G475263_T02|PACid:20831394
Domain Number 1 Region: 101-207
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.45e-33
Family B3 DNA binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G475263_T02|PACid:20831394
Sequence length 624
Sequence
MAQGAGRDPEELFEELWRACAGPLVELPQTNERVFYFLQGHLEQLQEPTDPALLAEQIKM
FQVPNKILCKAETETDEMYAQITLQPEPDQVDLPQLPEPPLQETSRPVVHSFCKILTPSD
TSTHGGFSVLRRHANECLPALDMSMPTPTQELITKDLHGSEWRFKHIYRGQPRRHLLTTG
WSTFVTSKKLIAGDAFVYLRLSQSQYIVRLNKYLESSKIGFDVGMRFKMSFEGDDVPIKK
FSGTVVDKGDLSPQWQGSEWKTLKVKWDEATNLNGPERVSSWEIEPFDASAPAITMPVQP
SMKNKRPRETAEGLDIHALEPAQEFWLSGRPEQHEKTSVSSSEPKHQVAWTSERAGYSAM
SSSICQNSAVTGSWFKGFNSSGSHPSLPEISQKLFQVTSNDARVPPWPGLSAYHADEPSS
KLSCNTALCSYQTEEVAPRFSNAVEEEKKEPGMFRLFGVNLINHARSSATADKTSVGAGE
TSARAAGSFEDSAQLSRVTKDHTHMVNGSPREIQSHQSCSGRSRIKVQMHGNDVCRAVDL
GNLDGYEQLMGEVGEMFEIKDLGSKEKEEWKVTFINDENETMEVGAVPWQEFCQMVRKIV
IHSIGDRGHMEACPCLGQDGKRDY
Download sequence
Identical sequences GRMZM2G475263_T02|PACid:20831394 GRMZM2G475263_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]