SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM5G834874_T01|PACid:20881769 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM5G834874_T01|PACid:20881769
Domain Number 1 Region: 218-300
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000471
Family B3 DNA binding domain 0.0027
Further Details:      
 
Domain Number 2 Region: 871-932
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000373
Family B3 DNA binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM5G834874_T01|PACid:20881769
Sequence length 937
Sequence
MGGGNEFLVGMTGSAPDSARQKRCHDTANGEVRDGDTVVKNGKTSDAASVEKREKKEHLF
KCSAYHGKDTDMWSGDQRINKSRVPAALCEQGREMDDDLNKTNSKERMMGVELDKEKTIT
SDDCSKVEGKKKFNTASPEEERKKKPHNASTGKNMQRDDDKEVVRIMSNSDTKVKIKKVS
TPLPKKEKNKEKLNKTYREKKMQAADSKMRSCYSGVKKGKVIPRIVAPRLEYLTNQLVYL
KDSKGKCLKVLVSKVVDSLAFDQGWDVFVSNHLIKWGEFLLFEYIAERTFSVRVFGTDSC
ERLDFNPESTNKGETKKQAWSNMPPDDLVVTDGISENSGYYVSGECPRTKVPQTCHVTCN
TKKDPKRVERVVGSGPVAQDISGNLIGPQCKTKGTPLCSKGKTVIMIIDSEDSEPSAHEK
EDTMKLATSGPDSDISLVAVNTNEDPIRAQSGIGNGPSAVLADEKGNFPEIECGTKCISA
TCSEVKTVSQIISATALLDLHDSDENLGRKQRTNAIPLDSRTTAEDYHNYSKMIIIQNFN
RKYEAPGGFRCLEKWRKDVVNNQTALDCTAPIKHENPQKTDGMLVDGYGLIELNPVDEYI
CSEGNHECVQPVFTMPIKEPSSADRVIDCGRDGTEINYSINEKDGEVDTKCIQTRPYDVK
ASVLFHSKEEEFIAVVLLFYLKQKENKPMGSIVHSQSNNVWLSANPVVAGKYAALGLNPS
RSEGSCAFIESMLTGSIEKTSSPDEISKCKNSMMETAHNVNGKGGGTTAQFETKMDQAEP
ARSGVRSKICNSVVPANESEHRSTKQEGRMSSNREVPESLLPTKDEIPEPDHHSPPEINF
QLCIPDTTQKWLDLSKSLSNAVRRQRRHDYDVIMLKDPKKRLWPVVYHDSLLFVGFTAGW
KHFVASNDLRAGDVCELVKEPDDGEPVYSVRMSDHKI
Download sequence
Identical sequences GRMZM5G834874_T01|PACid:20881769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]