SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM5G871407_T01|PACid:20852881 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM5G871407_T01|PACid:20852881
Domain Number 1 Region: 219-306
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 0.0000000000418
Family Transcriptional factor tubby, C-terminal domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM5G871407_T01|PACid:20852881
Sequence length 357
Sequence
MAETPRPTPFSPSTCRSSPLRPHACSSSGPAPFAAYSTHCKRSGPRKRGPLLSVVPPPPS
PSSLPLDSLPLDSLPLHLTAPTPTPWRSHQTLTPPHSFLSPATQALVLAISSHPLPTLAA
FLASRRDELLRADITSLLKALELPGHWEWALALLRWAGKEGATDASALELVVRALGREGQ
HCVLLDEMPLPPSSRLDVSAYTTVLHALELFAELQRLGYEIKRDKSKTTYHLYLCLTTAV
LTENGEFLLSARRNRKTSCTSILSRWMLTTYQDLPTHIGKLRSNFLSTKFMISNMQPPYS
GAVVPHAGRTNRRFDSRKVSLRKVSPKLRQVIDLKRHFKRAGKSTALPKYNAQRPAH
Download sequence
Identical sequences GRMZM5G871407_T01|PACid:20852881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]