SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM5G874163_T02|PACid:20850596 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM5G874163_T02|PACid:20850596
Domain Number 1 Region: 114-265
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.06e-44
Family B3 DNA binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM5G874163_T02|PACid:20850596
Sequence length 393
Sequence
MGIDLNMVDGEGHERRPPPVTCRELWHACAGPVVALPRRGSLVVYLPQGHLAAAGGGDVA
ADLPPHVVCRVADVELCADAATDEVCARLALVAEGEAFGRNLGGGGVEGDDGMEDFDAER
KSGMLHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYNQLRPSQELVAKDLHGAKWKF
RHIYRGQPRRHLLTTGWSSFVNKKKLVSGDAVLFLRGDDGELRLGVRRAIQLKNEALFED
FNSDSTKRHSLTAVADSLKNRSVFHISYNPRATASEYIIPYAKFLKSLNHPVCIGARINF
QCHNEDVSERRSGVVVRISEIDPMKWPGSKWRSLLVRWEDGAECNGQDRVSPWEIEIAGG
SVSVSHSLSASSSKRTKLCPQGNLDVPAMCKLS
Download sequence
Identical sequences GRMZM2G085248_P01 GRMZM5G874163_T02|PACid:20850596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]