SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM5G887077_T01|PACid:20825378 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM5G887077_T01|PACid:20825378
Domain Number 1 Region: 358-714
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.29e-116
Family Motor proteins 0.000000661
Further Details:      
 
Domain Number 2 Region: 22-150
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.57e-24
Family Calponin-homology domain, CH-domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM5G887077_T01|PACid:20825378
Sequence length 793
Sequence
MTEPRRVSFRDGCLASRKAEEAAWRRHQAAAWLQAMVGSLGLPPYPSEQEFVASLRNGIV
LCKAINKLQPGAVTKIITNAPSNSQPLTAFQYFENIRNFLVAVNKLKLTSFEASDLDKDN
LDAGTVGKIVDCVISLKSYHEWKQAGGANGPNKYMKSPLAVRSSQIQSENVASGPSPSLK
RLDLTEVDADTQTFQNLDPNMKDCAFADAVEKLQKVIVDSMLSSKENIDQDILKKVPSKL
IGAVLASQLGKEQFKHLQLLSPEKLIAENEPTHCIEHPNSPIESKQLLLQAHETELLDLK
KMFQDVKVNFRSLQTQFRDDMAKLGENIQDLSKAALGYNQAVKENRNLYNMLQELRGNIR
VFCRIRPLLHSESISSIEHVGTDGSVMVCDPVKPQSAHKIFQFNKVFGPTTTQDEVYKET
QPLVRSVMDGYNVCIFAYGQTGSGKTHTMCGPSGGLSKDYGINYMALNDLFNISTSREDV
KYDIRVQMVEIYNEQVRDLLNEDRSSTKLDIRASLNNGLSNLPDAKICPVQSPSDVINLM
QLGEKHRASGSTAMNHRSSRSHSILTVHVNGKDIAGNVSRSSLHLVDLAGSERVDRSEAT
GDRLKEAQHINKSLSCLGDVINALAQKNSHIPYRNSKLTQLLQSSLGGNAKMLMFAHISP
DAESCAETLSTLKFAQRASTVELGTALANKESSEVRELKEQVDTLKKALASKELEKTTLK
VKGSATTSERTKQVLDCTPPRPRRLSLENASDKARMPERKILKSPRSAVGITHDKECNTD
AFRHANHHESLIQ
Download sequence
Identical sequences GRMZM5G887077_T01|PACid:20825378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]